ERH (M07A), Mouse anti-Human, Clone: 1H4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ERH.

Brand:  Abnova H00002079-M07A.200uL

Product Code. 16164651

Description

Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

Specifications

• Antigen: ERH
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC014301
• Gene Symbols: ERH
• Immunogen: ERH (AAH14301,1 a.a. ∽ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 2079
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1H4
• Description: Mouse monoclonal antibody raised against a full-length recombinant ERH.
• Gene: ERH
• Gene Alias: DROER/FLJ27340
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ