homeobox C8, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human HOXC8 protein.

Brand:  Abnova H00003224-B01P.50ug

Product Code. 16129544

Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq

Sequence: MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD

Specifications

• Antigen: homeobox C8
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human HOXC8 protein.
• Gene: HOXC8
• Gene Alias: HOX3/HOX3A
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_022658.3
• Gene Symbols: HOXC8
• Immunogen: HOXC8 (NP_073149.1, 1 a.a. ∼ 242 a.a) full-length human protein.
• Quantity: 50 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 3224
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG